PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG026186.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family LBD
Protein Properties Length: 295aa    MW: 32797.9 Da    PI: 7.0276
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG026186.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-4271061100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qpkkfa vhk+FGasnv kll++l+  +reda++sl+yeAe r+rdPvyG+vg+i+ lqq+l+ql+++l ++k
  CCG026186.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPKKFASVHKVFGASNVAKLLNELNAAQREDAVNSLAYEAEERLRDPVYGCVGLISILQQRLKQLQNDLYSAK 104
                  7*********************************************************************************************9998 PP

       DUF260  99 ee 100
                  +e
  CCG026186.1 105 KE 106
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6446107IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-427104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPKKFASVH KVFGASNVAK LLNELNAAQR  60
EDAVNSLAYE AEERLRDPVY GCVGLISILQ QRLKQLQNDL YSAKKELVNY VEGQAMLPML  120
MQPQHLGNPS SSTVMQHNGM PMMGIPSVGQ MGMRADTHQH HHAHPQQIYE AQQLAAVVAA  180
REQEMIRVYE QQHQHHTQAQ RQHEIVRFNG GFDPANSVAA TGFNHVNPAA AMSPSLALGT  240
FDNSYQIQSQ GEPQPNQLQP ELLLQPQSQQ QQPQQLLQHP KSESEEGRST VGPSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009273.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011009274.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011009275.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_011009276.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ35e-88LBD36_ARATH; LOB domain-containing protein 36
TrEMBLB9H6D50.0B9H6D5_POPTR; LOB domain protein 28
STRINGPOPTR_0005s14150.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.18e-85ASYMMETRIC LEAVES 2-like 1